IGF-1 LR3
Also known as: Long Arg3 IGF-1, R3 IGF-1, LR3, LongR3-IGF-I, IGF-1 LR3
The molecule was engineered specifically to evade IGFBP sequestration and extend the free-active half-life of IGF-1 in circulation. The preclinical anabolic biology that follows from that engineering is well characterized. Published human pharmacology of IGF-1 LR3 specifically is essentially absent — the closest clinical evidence base is for native IGF-1 in pediatric growth-failure syndromes, a different molecule and a different population.
- Primary sources
- 0
- Mechanism dossiers
- 10
- Documented cycles
- 0
- Last reviewed
- 2026-05-18
10 decision
Across all tiers
IGF-1 LR3 is an 83-amino-acid recombinant analog of human insulin-like growth factor-1, engineered from the native 70-residue IGF-1 by two modifications: a 13-residue hydrophobic N-terminal extension (MFPAMPLSSLFVN — the "Long" prefix) and substitution of arginine for the native glutamate at position 3 of the IGF-1 scaffold (the "R3" / "Arg3" substitution). The mature single-letter sequence is MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA. Both modifications were introduced by the Adelaide group of Francis, Ross and Ballard in the early-1990s recombinant-protein engineering work that defined the molecule: King et al., J Mol Endocrinol 1992, 8(1):29–41 characterized the E. coli expression of IGF-I and the Gly3 and Arg3 variants as fusion proteins, and Francis et al., J Mol Endocrinol 1992, 8(3):213–223 established that the enhanced biological potency of Long [Arg3]-IGF-I in IGFBP-rich cell systems was driven by impaired IGFBP binding rather than by altered type-1 IGF-receptor affinity. In assays without secreted IGFBPs, Long [Arg3]-IGF-I was in fact less potent than native IGF-I at the type-1 receptor; the in vivo potency advantage emerges entirely from the IGFBP-evasion side of the design rather than from any intrinsic receptor-binding gain. The N-terminal extension principally facilitates correct oxidative folding of the recombinant fusion protein during E. coli expression.
The pharmacological action is IGF-1 receptor (IGF1R) agonism, identical in principle to native IGF-1. IGF1R is a heterotetrameric receptor tyrosine kinase; ligand engagement triggers autophosphorylation of the intracellular kinase domain, recruits insulin-receptor substrate (IRS-1, IRS-2) and Shc adapter proteins, and propagates signal through the PI3K-Akt-mTOR cascade and the Ras-Raf-MEK-MAPK cascade. The downstream consequences are the canonical IGF-1 effects: anabolic protein synthesis, cellular proliferation, anti-apoptosis, glucose uptake, and (at sufficient ligand concentration) cross-reactivity at the insulin receptor and at IGF1R/IR hybrid receptors. What distinguishes LR3 from native IGF-1 functionally is not the receptor pharmacology but the disposition: in circulation, ~99% of native IGF-1 is sequestered by the IGFBP-3 / acid-labile-subunit ternary complex with a free-fraction half-life on the order of minutes; LR3, by virtue of the Arg3-induced disruption of the IGFBP-binding interface, evades that sequestration and circulates predominantly as free, receptor-available molecule, with practitioner and vendor characterizations placing the functional half-life in the 20–30 hour range.
The honest framing of IGF-1 LR3 sits on four pillars, and the page is written around them.
First, the preclinical pharmacology of LR3 specifically is substantially characterized. The Tomas-Ballard group at CSIRO Adelaide established the in vivo anabolic profile across the early-1990s rodent literature. Tomas et al., Biochem J 1991, 276(Pt 2):547–554 demonstrated that recombinant IGF-I and the binding-protein-evading analog des(1-3)IGF-I produced weight gain, nitrogen retention, and stimulated muscle protein synthesis in streptozotocin-diabetic rats at doses producing roughly 70% of insulin's anabolic effect without correcting glucosuria — the first clear demonstration that IGF-1 axis stimulation could partially substitute for insulin's anabolic action without normalizing carbohydrate metabolism. Tomas et al., J Endocrinol 1996, 150(1):77–84 extended the series to systemic injection and reported that Long [Arg3]-IGF-I was approximately 2.5-fold more potent than native IGF-I in dexamethasone-catabolic rats — striking specifically because LR3 binds the type-1 IGF receptor approximately 3-fold less well than native IGF-I, so the in vivo potency advantage is a kinetic phenomenon (more free ligand reaching the receptor) rather than a receptor-affinity gain. The rodent literature collectively reports increases in muscle protein synthesis, nitrogen retention, lean body mass, organ growth, and intestinal mass on LR3 administration.
Second, published controlled-trial data on IGF-1 LR3 specifically in humans does not exist. No Phase I pharmacokinetic study, no Phase II efficacy trial, no Phase III program. The molecule has never been clinically developed. The closest clinically grounded evidence base in the IGF-1 ligand class is for native IGF-1 — mecasermin, marketed as Increlex — which is a different molecule. The mecasermin pivotal evidence rests on long-term open-label cohort studies in children with severe primary IGF-1 deficiency due to growth hormone insensitivity. Chernausek et al., J Clin Endocrinol Metab 2007, 92(3):902–910 reported on 76 children treated with subcutaneous rhIGF-I at 60–120 μg/kg twice daily for up to 12 years: height velocity rose from 2.8 cm/yr at baseline to 8.0 cm/yr in the first year. Hypoglycemia was reported by 49% of treated subjects, injection-site lipohypertrophy by 32%, and tonsillar/adenoidal hypertrophy by 22%. Backeljauw and Underwood, J Clin Endocrinol Metab 2001, 86(4):1504–1510 reported the foundational 6.5–7.5-year clinical-research-center cohort that anchored the mecasermin clinical-development case. The FDA approved Increlex on 30 August 2005 for the long-term treatment of growth failure in children with severe primary IGF-1 deficiency. None of this evidence base maps onto subcutaneous LR3 dosing in healthy adults for body composition. The molecule, the patient population, the dosing regimen, and the prespecified endpoints differ in every load-bearing respect.
Third, the cancer-risk conversation is structurally different for direct IGF1R agonists than for endogenous GH-axis activators. Epidemiologic associations between circulating IGF-1 and incident cancer are reproducible across large prospective cohorts. Renehan et al., Lancet 2004, 363(9418):1346–1353 pooled 21 studies with 3,609 cases and 7,137 controls and reported odds ratios for prostate cancer (1.49, 95% CI 1.14–1.95) and premenopausal breast cancer (1.65, 95% CI 1.26–2.08) at the 75th vs 25th percentile of circulating IGF-1. Pollak, Nat Rev Cancer 2008, 8(12):915–928 reviews the mechanistic literature linking IGF1R signaling to proliferation, anti-apoptosis, and oncogene transformation. The translation from epidemiologic association to direct-agonist intervention is not symmetric — high serum IGF-1 in observational data is a marker of an entire metabolic-endocrine background, not just of receptor activation — but the relevant asymmetry on the other side is that endogenous GH-axis activators (CJC-1295, Ipamorelin, Tesamorelin, MK-677, and the upstream parent Somatropin) retain pituitary and somatostatin feedback that constrains the IGF-1 elevation pattern, while exogenous IGF1R agonism bypasses every upstream regulator. The GH axis dossier walks the comparative framing. The mouse longevity literature points in the same direction — Holzenberger et al., Nature 2003, 421(6919):182–187 reported that IGF1R-heterozygous knockout mice live ~26% longer than wild-type littermates, the inverse phenotype of chronic IGF1R activation. No human longevity data on chronic exogenous IGF1R agonism exists in either direction.
Fourth, the insulin-receptor cross-reactivity produces a real hypoglycemia signal that is materially worse for LR3 than for native IGF-1 because of the longer free-fraction exposure. Hypoglycemia was the most consistent clinically meaningful adverse event in the mecasermin pediatric dataset (49% in Chernausek 2007), and the mecasermin FDA label specifically requires dosing within 20 minutes of a meal to mitigate it. The mecasermin hypoglycemic window is narrow because the free-fraction kinetics of native IGF-1 are on the order of minutes. LR3, by design, extends the free-active circulating fraction by an order of magnitude or more, extending the hypoglycemic window over a similar interval — a 20–30 hour exposure profile in which insulin-receptor cross-reactivity can manifest without the structured meal-timing protocol that mecasermin labeling relies on. Severe hypoglycemia is anecdotally reported in the gray-market practitioner literature; the published peer-reviewed case-report database on LR3 hypoglycemia is essentially empty, which reflects the absence of controlled clinical use rather than absence of mechanism.
LR3 is routinely conflated in practitioner literature with two related molecules: des(1-3) IGF-1 is a separate N-terminally truncated analog (the first three residues removed rather than extended) with different pharmacology; mecasermin (Increlex) is the native 70-residue IGF-1 and the only molecule in the class with an FDA-approval pathway. Stacking with the GH-axis secretagogues is theoretical — those agents work upstream by amplifying pituitary GH output and endogenous hepatic IGF-1 production, while LR3 supplies exogenous IGF1R agonism downstream of the entire feedback architecture; no controlled human data on the combination exists, and the cancer-risk and hypoglycemia concerns scale rather than cancel. The peptide stacking critic response walks the broader pattern. The closest sibling in the corpus for evidence-quality shape is Follistatin — another gray-market peptide whose preclinical muscle-pathway biology is well characterized, whose published human pharmacology is essentially absent, and whose parent clinical-development pathway provides the load-bearing controlled data on the broader pathway rather than on the peptide form itself. The WADA prohibited status registry and sarcopenia and peptides dossier cover the regulatory and indication framing.
Goal-oriented comparisons and mechanism deep-dives that cover IGF-1 LR3. Decision guides compare the realistic options for a goal (peptide / drug / lifestyle); mechanism dossiers walk the pathway in depth.
Decision guides all guides →
Starting point
Compounding pharmacy regulatory landscape
Read
Starting point
DEA scheduling and criminal-law peptide landscape
Read
Starting point
IGF-1 lab platform reference range divergence
Read
Starting point
Pediatric peptide use review: approved, off-label, and the gray-market adolescent question
Read
Starting point
Peptide allergens and excipients reference
Read
Starting point
Peptide bioavailability comparison reference
Read
Starting point
Peptide cold-chain logistics and travel reference
Read
Starting point
Peptide dosing in hepatic impairment: a reference
Read
Starting point
Peptide injection technique: a technical reference
Read
Starting point
Peptide manufacturing technical reference
Read
The published peer-reviewed human safety dataset for subcutaneous IGF-1 LR3 specifically is empty. Safety considerations derive from three adjacent literatures: the mecasermin pediatric clinical record (Chernausek 2007, Backeljauw 2001) for native IGF-1 axis activation in chronic dosing; the IGF-1 / cancer epidemiology (Renehan 2004, Pollak 2008) for proliferation-pathway concerns; and the rodent LR3 pharmacology (Tomas 1991, Tomas 1996) for the magnitude and tissue distribution of IGF1R activation under exogenous LR3 dosing. The two most clinically meaningful signals are hypoglycemia from insulin-receptor cross-reactivity over the extended free-fraction exposure window LR3 provides, and the pathway-level cancer-risk concern from direct IGF1R agonism without upstream feedback regulation. Tonsillar/adenoidal hypertrophy, injection-site lipohypertrophy, and benign intracranial hypertension are documented in the mecasermin pediatric label; the extent to which any of these scale to adult LR3 dosing is uncharacterized. Cardiac hypertrophy is mechanistically plausible at chronic high-dose IGF1R activation but is not characterized in published LR3-specific data. WADA-funded detection literature on the analog series (Thomas et al., Anal Bioanal Chem 2014, 406(11):2607–2620) lists LongR3-IGF-I, R3-IGF-I, and des(1-3) IGF-I as explicit analytical targets in plasma — confirming the regulatory status and underscoring that the analog series is not pharmacologically interchangeable with endogenous IGF-1.
Contraindications
- Active or past cancer (direct IGF1R agonism bypasses upstream GH-axis feedback; epidemiologic associations between circulating IGF-1 and prostate, premenopausal breast, and colorectal cancer risk are reproducible across large cohorts)
- Diabetes mellitus or significant insulin resistance without endocrinologist oversight (insulin-receptor cross-reactivity at higher doses produces a hypoglycemia signal materially longer-windowed than mecasermin's)
- Pregnancy, breastfeeding, or active fertility planning (no controlled safety data; IGF1R signaling participates in fetal development and lactation physiology)
- Pre-existing cardiomyopathy or unmonitored cardiac disease (chronic IGF1R-mediated proliferative signaling; not characterized in human LR3 data)
- Active proliferative retinopathy or other GH/IGF-1-sensitive ophthalmic disease (class concern shared with native GH and mecasermin)
- Family or personal history of pituitary tumor, intracranial mass, or active acromegaly
- Patients under 21 (no controlled safety data; broad cell-growth-regulation effects may interact with developmental tissue)
- Athletes in WADA-tested competition (prohibited at all times under S2.3 Growth Factors and Growth Factor Modulators; detection methodology specifically targets LongR3-IGF-I and the analog series)
- General principle: the published human pharmacology base for subcutaneous IGF-1 LR3 specifically is empty. The contraindication list reflects the mechanistic biology of IGF1R agonism, the adjacent mecasermin clinical safety record, and the cancer-risk epidemiology rather than trial-derived LR3 safety.
More like this in your inbox.
The free 6-page PDF — Top 10 Peptides Worth Knowing — covers the evidence and the boundaries on the peptides every curious biohacker eventually encounters.
One unsubscribe click ends it forever. The address is never sold and never shared with vendors.
07·Member discussion
No member discussion yet.
Member-only conversation lives here — cycle notes, practitioner commentary, pattern-matching. Be the first paying member to start the thread.