Pituitary Adenylate Cyclase-Activating Polypeptide
Also known as: pituitary adenylate cyclase-activating polypeptide, PACAP-38, PACAP-27, ADCYAP1, bocunebart, Lu AG09222
PACAP is the second-validated migraine-mechanism neuropeptide after CGRP — the same trigeminal-sensory-nerve release, the same migraine-provocation result when infused into migraineurs, and the same antibody-blockade therapeutic strategy that produced the CGRP class. The Lundbeck HOPE Phase 2 (NEJM 2024) is the first controlled-trial evidence that anti-PACAP blockade reduces monthly migraine days in patients who failed the CGRP class.
- Primary sources
- 0
- Mechanism dossiers
- 1
- Documented cycles
- 0
- Last reviewed
- 2026-05-18
1 decision
Across all tiers
PACAP is a 38-amino-acid neuropeptide of the secretin/glucagon/VIP superfamily, isolated from ovine hypothalamic extracts and announced in Miyata, Arimura, Dahl et al., Biochem Biophys Res Commun 1989, 164:567–574 on the basis of its potency as a stimulator of cAMP production in cultured rat anterior pituitary cells — the activity that names the molecule. The mature peptide carries the sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK, with a molecular mass near 4534 Da; the C-terminal-truncated PACAP-27 isoform (residues 1–27, amidated C-terminus, ~3147 Da) is isolated from the same purification and shares the receptor pharmacology. The peptide is encoded by the ADCYAP1 gene and is conserved with high homology across mammals, with sequence divergence of only one to three residues across chicken, frog, and salmon orthologues. Endogenous PACAP is expressed densely in the central nervous system — hypothalamus, brainstem, sphenopalatine ganglion, trigeminal ganglion — as well as in peripheral autonomic nerves, the enteric nervous system, the adrenal medulla, and reproductive tissues.
The receptor pharmacology is three-receptor and overlaps with VIP on two of the three. PAC1 (the PACAP-specific receptor, encoded by ADCYAP1R1) binds PACAP with substantially higher affinity than VIP and is the receptor isoform expressed prominently in trigeminal sensory neurons, sphenopalatine ganglion neurons, and the meningeal mast cells implicated in migraine pathophysiology. VPAC1 and VPAC2 are the shared PACAP-VIP receptors covered in the VIP entry and elsewhere — both class B (secretin-family) G-protein-coupled receptors that bind PACAP and VIP with comparable affinity and signal predominantly through Gαs-mediated adenylyl cyclase activation. The migraine-mechanism case has converged on PAC1 as the load-bearing receptor isoform — the receptor density in trigeminal sensory and sphenopalatine ganglia matches the anatomical pattern of CGRP receptor distribution that licenses the CGRP-class therapeutic. The comprehensive receptor and signalling synthesis is Vaudry et al., Pharmacol Rev 2009, 61:283–357, the canonical 20-years-after-discovery review of PACAP pharmacology. The CGRP-versus-PACAP migraine-pathway comparison is developed in Kuburas and Russo, J Headache Pain 2023, 24:34 — both neuropeptides are released from trigeminal sensory nerves during migraine, both produce migraine-like attacks when infused into migraineurs, both have potent vasodilatory action on the dural circulation, and both signal through Gαs-coupled GPCRs on trigeminal afferents and dural vasculature. The signalling pathways converge but are not redundant: the CGRP and PACAP pathways activate downstream effectors with different kinetics, engage different neuronal subsets within the trigeminal system, and produce non-overlapping clinical-response patterns in patients treated with monoclonal antibodies targeting one pathway or the other.
PACAP is the second peptide-pathway migraine target to reach controlled-trial validation after the CGRP class, and the editorial arc is one of the cleaner four-decade mechanism-to-medicine translations in neurology — the 1989 isolation paper on the basis of pituitary adenylate cyclase activation, the 2009 provocation experiment demonstrating that intravenous PACAP-38 triggers migraine-like attacks in migraineurs, and the 2024 HOPE Phase 2 trial demonstrating that an anti-PACAP monoclonal antibody reduces monthly migraine days in patients who failed prior preventives. The migraine and peptides dossier develops the broader clinical-decision landscape across the CGRP class and the emerging PACAP class; this peptide entry covers the molecule, the receptor pharmacology, and the clinical-development pipeline.
The causal-provocation evidence is the load-bearing translational result. Schytz, Birk, Wienecke, Kruuse, Olesen and Ashina, Brain 2009, 132:16–25 randomised 12 patients with migraine without aura and 12 healthy controls to a double-blind crossover infusion of either PACAP-38 at 10 pmol/kg/min for 20 minutes or placebo. PACAP-38 produced immediate headache in both groups and delayed migraine-like attacks specifically in the migraine population — replicating the Lassen 2002 paradigm with intravenous CGRP that established the CGRP-causal-sufficiency case, but with a different neuropeptide. The headache time course (immediate mild headache followed by delayed migraine-like attack at a median of approximately six hours post-infusion) and the migraineur-versus-control asymmetry were the same pattern that the CGRP provocation studies had reported. The 2009 result established PACAP as causally sufficient to trigger migraine in susceptible patients and licensed the multi-decade therapeutic-development effort. The subsequent provocation literature surveyed in Ashina, Hansen and Olesen, Nat Rev Neurol 2017, 13:713–724 extended the causal-sufficiency picture across cluster headache and other primary headache phenotypes.
The PACAP class development arc has had two failure modes before the 2024 HOPE success and is worth describing honestly. The first attempted target was the PAC1 receptor — the PACAP-specific receptor isoform that the trigeminal-sensory expression pattern made the obvious receptor pharmacology target. AMG 301 (Amgen) was a humanised monoclonal antibody to the PAC1 receptor, evaluated in Ashina, Doležil, Bonner et al., Cephalalgia 2021, 41:33–44 — a Phase 2 randomised double-blind placebo-controlled trial in 343 patients with episodic migraine, with 12 weeks of subcutaneous AMG 301 at 210 mg every four weeks, 420 mg every two weeks, or placebo. The primary endpoint of mean change in monthly migraine days from baseline did not separate from placebo: least-squares mean reduction of −2.2 days in both AMG 301 arms versus −2.5 days on placebo. The trial concluded that PAC1-receptor blockade as implemented by AMG 301 offered no benefit over placebo for migraine prevention. The molecule was discontinued. The 2021 negative result raised the open question of whether PAC1-receptor antibody pharmacology was the wrong therapeutic strategy (insufficient potency, insufficient receptor coverage, the wrong receptor isoform target) or whether the PACAP pathway was simply not therapeutically tractable for migraine — a question the second-generation development effort has partially answered.
The second-generation approach pivoted from receptor-targeting to ligand-targeting — binding the PACAP peptide in circulation before it reaches the receptor, in the same pharmacological pattern that fremanezumab, galcanezumab, and eptinezumab pursued for CGRP against the receptor-targeting erenumab. Lu AG09222 (bocunebart, Lundbeck) is a humanised IgG1 monoclonal antibody to the PACAP ligand, evaluated in the HOPE Phase 2 trial — Ashina, Phul, Khodaie, Löf and Florea, N Engl J Med 2024, 391:800–809. The trial randomised 237 adults aged 18–65 with episodic or chronic migraine and two or more prior preventive treatment failures (including anti-CGRP-class failures) in a 2:1:2 ratio to a single intravenous infusion of Lu AG09222 750 mg, Lu AG09222 100 mg, or placebo, with primary endpoint of mean change from baseline in monthly migraine days over the four weeks after infusion. The 750 mg arm produced 6.2 fewer monthly migraine days versus 4.2 on placebo — a between-arm difference of −2.0 days (95% CI −3.8 to −0.3; P=0.02). The 100 mg arm did not separate from placebo on the primary endpoint, establishing a dose-response signal. The safety profile across the four-week observation window was unremarkable, with no drug-related serious adverse events. The HOPE result is the first controlled-trial evidence that PACAP-pathway blockade reduces monthly migraine days in patients who have failed prior preventives — and the validation of the ligand-targeting strategy that the AMG 301 receptor-targeting failure had left open.
The Phase 2b PROCEED trial extended the HOPE signal across multiple doses and routes of administration through 2025–2026. The trial design included subcutaneous and intravenous administration arms in patients with one to four prior preventive failures. The subcutaneous cohort was discontinued at a planned interim futility analysis in early 2025; Lundbeck pivoted the remaining program to intravenous dosing. The intravenous PROCEED arm met its primary endpoint, with the 750 mg dose producing a 5.8-day reduction in monthly headache days versus 4.1 days on placebo over 12 weeks, and Lundbeck announced plans for a Phase 3 program in 2026 — see the investigational peptide pipeline tracker for the broader pipeline context. The pivotal Phase 3 readouts that would license a PACAP-class therapeutic are expected in the 2027–2028 window. As of mid-2026, no anti-PACAP or anti-PAC1 therapeutic is FDA-approved.
The clinical-positioning question is the one the migraine and peptides dossier develops in detail: the CGRP class produces a 50%-response rate in roughly 40–60% of trial populations, with substantial numbers of patients who do not respond to one CGRP-class agent and who do not respond to switching across the four monoclonal antibodies. The HOPE trial enrolled patients who had failed two or more prior preventives including anti-CGRP-class therapy, and the positive result in that population is the proof-of-concept that PACAP-pathway blockade addresses migraine pathophysiology that the CGRP class does not fully engage. The two pathways are not redundant — the trigeminal sensory release of both peptides during a migraine attack appears to drive partially independent signalling that the two therapeutic classes can address separately. The honest framing is that the PACAP class, if approved, would extend the mechanism-specific preventive options for the ~30–40% of patients in whom the CGRP class is inadequate, rather than replacing it as a first-line therapy. The class would not be expected to be uniformly effective either — the HOPE 50%-responder rate was 32% on the 750 mg dose versus 27% on placebo in the prior-treatment-failure population, indicating substantial residual non-response that future trial work will need to characterise.
The receptor-pharmacology comparison with VIP is structurally informative. The two peptides share VPAC1 and VPAC2 receptors but have distinct primary biology — PACAP signals through PAC1 with high specificity, while VIP does not. The VIP entry covers the immunomodulatory pulmonary, gastrointestinal, and CIRS-context applications of VIP itself; the PACAP entry is principally a migraine-mechanism page because the therapeutic development pipeline that targets the PACAP system is migraine-focused. The shared-receptor-family framing matters for the peptide receptor pharmacology atlas categorisation — both molecules sit in the secretin/glucagon/VIP/PACAP class B GPCR family, alongside the CGRP-receptor CLR-RAMP1 heterodimer covered in the CGRP-class entry. The class B GPCR family is the receptor-superfamily target for the bulk of the modern migraine-pathway pharmacology.
Goal-oriented comparisons and mechanism deep-dives that cover Pituitary Adenylate Cyclase-Activating Polypeptide. Decision guides compare the realistic options for a goal (peptide / drug / lifestyle); mechanism dossiers walk the pathway in depth.
Decision guides all guides →
PACAP itself is not a therapeutic agent and the safety profile relevant to readers is the safety profile of the anti-PACAP and anti-PAC1 monoclonal antibody therapeutic candidates. The IV infusion of PACAP-38 used in research-provocation studies produces flushing, facial vasodilation, and immediate mild headache as the predictable consequences of the molecule's vasodilatory action; the migraine-like attack that follows in susceptible patients is the experimental endpoint rather than an adverse event in that protocol. The infusion protocol — 10 pmol/kg/min over 20 minutes, characterised across Schytz et al. 2009 and subsequent provocation studies — has been deployed in dozens of small-sample human studies without serious safety signals beyond the predicted vasodilatory and headache effects. The molecule is not deployed therapeutically in any approved indication.
The Lu AG09222 safety record across the HOPE Phase 2 trial and the subsequent PROCEED Phase 2b development was characterised as unremarkable through the four-week post-infusion observation window in HOPE and the 12-week IV-arm follow-up in PROCEED, with no drug-related serious adverse events. The molecule's relatively limited human exposure base — combined across HOPE, PROCEED, and the open-label-extension cohorts, on the order of several hundred patients with months-rather-than-years of follow-up — means the long-term safety profile is not yet characterised at the scale that the CGRP-class post-approval pharmacovigilance has accumulated. The class-level safety signals expected to emerge through Phase 3 and post-approval surveillance, by analogy with the CGRP class, are constipation (the gastrointestinal-motility consequence of any peptide-pathway antagonism that engages gut-relevant signalling), hypertension or other vascular signal (PACAP is a potent vasodilator, and chronic ligand-sequestration could affect baseline vasomotor tone), and the general considerations of any chronic biologic therapy — injection-site or infusion-site reactions, hypersensitivity events in a small fraction of users, and the theoretical immunogenicity concern that anti-drug antibodies could develop over chronic dosing. None of these signals have emerged at clinically significant rates in the published HOPE or PROCEED reports; they remain to be characterised at Phase 3 scale.
The AMG 301 anti-PAC1-receptor antibody, evaluated in Ashina et al. 2021, had an acceptable safety profile at the doses tested across the 12-week trial. The molecule was discontinued for efficacy rather than safety reasons. No PAC1-receptor antibody is currently in active development for migraine, but the receptor-targeting strategy has continued in adjacent indications including post-traumatic-stress and stress-related circuits that the PAC1 pharmacology overlaps with.
Pregnancy and lactation safety for the anti-PACAP class is unstudied. By analogy with the CGRP-class pregnancy positioning, the months-long terminal half-life of the IgG-class biologic carries a planned-conception washout consideration; specific guidance for Lu AG09222 has not been published and will not be until Phase 3 development matures or approval triggers a labelling decision.
Contraindications
- Pregnancy and lactation (no controlled human data for any anti-PACAP or anti-PAC1 antibody candidate; the months-long IgG terminal half-life carries a planned-conception washout consideration of approximately 4–5 months by analogy with the CGRP class, pending dedicated Lu AG09222 guidance)
- Hypersensitivity to the specific molecule or to formulation excipients (no anti-PACAP therapeutic is FDA-approved; this consideration applies to investigational use within Phase 2/Phase 3 trials only)
- Migraine-provocation IV PACAP-38 research protocols are not appropriate for clinical use and should not be confused with the therapeutic-blockade development pathway — the molecule itself triggers migraine attacks in susceptible patients by design
- Active uncontrolled cardiovascular or cerebrovascular disease — limited safety data exist for chronic PACAP-pathway antagonism in patients with compromised vascular reserve, and the recognised vasodilatory contribution of endogenous PACAP to the cranial and broader circulation suggests the precautionary approach until Phase 3 characterises the cardiovascular signal at scale
- Off-label use of any anti-PACAP antibody is not supported by the published evidence base; the molecule is investigational and is not appropriate as a generalised pain or neurological-symptom therapy outside trial enrolment
- The molecule is not appropriate for self-administered or compounding-pharmacy deployment — the antibody candidate is in clinical-trial development and is not available as a research peptide; the PACAP-38 peptide that is available as a research compound has the opposite pharmacology (migraine-provocation, not migraine-prevention) and should not be confused with the therapeutic-development candidate
More like this in your inbox.
The free 6-page PDF — Top 10 Peptides Worth Knowing — covers the evidence and the boundaries on the peptides every curious biohacker eventually encounters.
One unsubscribe click ends it forever. The address is never sold and never shared with vendors.
07·Member discussion
No member discussion yet.
Member-only conversation lives here — cycle notes, practitioner commentary, pattern-matching. Be the first paying member to start the thread.