Sermorelin
Also known as: GRF (1-29), GHRH (1-29) NH2, Sermorelin acetate, Geref, Geref Diagnostic
Sermorelin is the molecular grandfather of the GHRH-analog peptide class — the only one whose published RCTs sit in pediatric GH deficiency, and the only one whose modern biohacker-adjacent use case the original FDA file was never designed to test.
- Primary sources
- 2
- Mechanism dossiers
- 21
- Documented cycles
- 0
- Last reviewed
- 2026-05-18
2 tier 1
20 decision
Across all tiers
Sermorelin is the 29-amino-acid N-terminal active fragment of native human growth-hormone-releasing hormone, synthesized as the carboxy-terminal amide (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂). The 1982 isolation of human pancreatic GHRH at the Salk Institute established that the full-length 44-residue molecule is not required for activity — the 1-29 N-terminal fragment retains full intrinsic potency at the pituitary GHRH receptor. Sermorelin is that fragment, supplied as the acetate salt for parenteral use. Among the GHRH-analog peptides in this corpus, it is structurally the closest to endogenous human GHRH; tesamorelin extends the same scaffold to the full GHRH(1-44) with a hexenoyl modification at the N-terminus, and CJC-1295 takes a tetrasubstituted GHRH(1-29) backbone and (in the DAC variant) appends an albumin-binding linker.
Subcutaneously or intravenously administered sermorelin binds the GHRH receptor on anterior-pituitary somatotrophs and triggers endogenous pulsatile growth-hormone release; the GH pulse drives hepatic IGF-1 production downstream. The defining pharmacokinetic feature of the molecule is brevity. Plasma half-life is approximately 10 to 20 minutes after either intravenous or subcutaneous administration, with clearance values in the 2.4–2.8 L/min range and clinical effect on GH release resolving within roughly two hours. That is the shortest half-life of any peptide in the GHRH-analog family — tesamorelin sits at roughly 26–38 minutes through DPP-IV resistance, and CJC-1295 with DAC at 5.8 to 8.1 days through albumin tethering. The pharmacological story of the class can be read along that single axis: sermorelin produces a sharp pulse, tesamorelin a longer pulse, and CJC-1295 with DAC a continuous tonic signal. The GH axis dossier walks the pulsatile-versus-tonic distinction in more detail.
The mechanism-level argument for sermorelin is that the brief half-life produces a GH pulse signature that approximates physiological GHRH release, with the pituitary somatotrophs, the somatostatin negative-feedback loop, and the hypothalamic pulse generator all left intact rather than overridden. Walker 2006 frames this as the central pharmacological argument for using sermorelin in adult GH-axis modulation: episodic rather than continuous pituitary stimulation, with somatostatin-gated feedback preventing the kind of supraphysiological exposure profile that exogenous recombinant GH produces. That framing should be read as a mechanism claim, not an outcome claim — the comparison of pulsatile sermorelin to continuous rhGH on hard outcomes in non-deficient adults is not what the trial literature actually tests.
Sermorelin is the molecular grandfather of the GHRH-analog peptide family. It was synthesized in the early 1980s as the minimum-active fragment of the GHRH peptide isolated at Salk in 1982, and reached the US market under the Serono brand Geref in two regulatory steps. The diagnostic formulation (Geref Diagnostic, 0.05 mg/amp, NDA 19-863) was approved in December 1990 as a provocative test of pituitary somatotroph function in the workup of GH deficiency. The therapeutic formulations (0.5 mg/vial and 1.0 mg/vial, NDA 20-443) followed in 1997 for the treatment of idiopathic growth-hormone deficiency in pediatric patients with growth failure. EMD Serono notified the FDA in December 2008 that it was discontinuing both NDAs; the agency announced the withdrawal in the Federal Register of May 19, 2009, effective June 18, 2009. A 2013 Federal Register determination (Federal Register, 78 FR 14116, March 4, 2013) made the point explicit: Geref was not withdrawn for reasons of safety or effectiveness. The exit was commercial. That determination is what now anchors sermorelin's legal availability through 503A compounding pharmacies under the "component of an FDA-approved drug product" pathway.
The published trial base for sermorelin sits primarily in pediatric GH deficiency, not in adult anti-aging or recomposition use. The pediatric clinical case rests on small open-label and observational studies — Grunt et al., Acta Paediatrica 1995, 84:631-633 treated seven children with idiopathic short stature with subcutaneous sermorelin 30 µg/kg daily and reported that a subset demonstrated sustained height-velocity improvement over 24 months — together with the body of NDA-supporting work that underlay the 1997 Geref approval for pediatric idiopathic GH deficiency. The 1999 Prakash and Goa, BioDrugs 1999, 12:139-157 review summarizes the diagnostic and therapeutic pediatric trial base as it stood at the end of the 1990s: sermorelin at 1 µg/kg IV gave a relatively specific provocative test for GH deficiency with fewer false positives than other agents, and 30 µg/kg subcutaneous at bedtime drove catch-up growth in a portion of prepubertal children with idiopathic GH deficiency. The pediatric file is what earned the FDA approval; the indications it earned were narrow and the trial sizes were small.
The adult evidence base is thinner and structured around two questions that the regulatory file was not designed to answer. The first is whether nightly sermorelin restores age-attenuated GH/IGF-1 levels in healthy older adults; the second is what biological or functional outcomes such restoration produces. Khorram, Laughlin, and Yen, J Clin Endocrinol Metab 1997, 82:1472-1479 randomized 19 healthy adults aged 55-71 (n=10 women, n=9 men) to nightly subcutaneous [Nle27]GHRH(1-29)-NH₂ at 10 µg/kg or placebo in a 5-month single-blind crossover, and reported significantly increased nocturnal GH release, IGF-1 and IGFBP-3 elevation within two weeks, and lean-body-mass gain in men — a study small enough that it should be read as a mechanism and biomarker confirmation rather than a definitive effectiveness trial. Vittone et al., Metabolism 1997, 46:89-96 gave 11 healthy older men aged 64-76 a single nightly subcutaneous GHRH(1-29) dose of 2 mg for six weeks; nocturnal GH release rose and some isolated muscle-strength measures improved, but body weight, DEXA-measured body composition, glucose, insulin, and lipids did not change — and the authors specifically concluded that single nightly doses were less effective than multiple-daily-dose regimens at producing GH/IGF-1-mediated effects. Treat the Khorram and Vittone results as the load-bearing controlled adult evidence: GH and IGF-1 elevations are real and biomarker-confirmed; the body-composition and functional translation in non-deficient older adults is modest at best, and the trials that would settle the question in the modern compounding-pharmacy population have not been done.
The biohacker case for sermorelin sits downstream of that gap. The Walker 2006 editorial in Clinical Interventions in Aging is the most-cited articulation of the practitioner argument: that the off-label use of sermorelin is not legally prohibited in the way that off-label rhGH is, that the pulsatile, feedback-preserving GH stimulation it produces is mechanistically more defensible than exogenous rhGH for age-related GH decline, and that the molecule deserves serious clinical evaluation in adult-onset GH insufficiency. It is an editorial, not a trial — and it makes mechanism arguments, not outcome claims. Read the contemporary practitioner conversation around sermorelin through that lens: the legal-access argument is real, the pulsatile-mechanism argument is real, and the controlled outcome data in the indication that drives most current prescribing — adult body composition, recovery, sleep quality, and longevity-targeted use — does not yet exist. The GH-secretagogue discontinuation playbook covers the cycling logic that practitioner protocols overlay on this evidence base, and the /critic/sermorelin-naturalistic-fallacy response addresses the common framing that sermorelin's closer-to-endogenous sequence is intrinsically safer than the engineered analogs.
The honest framing has three parts. First, the published RCT-grade evidence sits in pediatric idiopathic GH deficiency, where the indication earned an FDA approval that the manufacturer voluntarily discontinued for commercial reasons. Second, the adult evidence base is small, mostly from the 1990s, and consistently shows that GH and IGF-1 biomarkers respond as the mechanism predicts — with translation to hard body-composition or functional endpoints in healthy older adults modest and route- and schedule-dependent. Third, the modern 503A-compounded use case for adult recomposition, sleep quality, and recovery is mechanistically plausible from the GHRH-axis literature and class-extrapolation from tesamorelin and CJC-1295, but is not what the Geref file was approved to test, and the controlled trials that would settle the question in that population have not been conducted. Sermorelin is the most-prescribed and most-studied GHRH-axis peptide in 2026 US clinical practice, and simultaneously the one whose marketed use case is furthest from its trial-grade evidence base.
Each entry below is graded on the four-tier evidence scale (peer-primary → practitioner) and carries an independent strength label that captures how robustly the source supports the claim it backs on this page.
- Tier 1 · Peer primarymoderateEffects of single nightly injections of growth hormone-releasing hormone (GHRH 1-29) in healthy elderly men
Vittone J, Blackman MR, Busby-Whitehead J, et al. · 1997 · Metabolism
- Tier 1 · Peer primarymoderateEndocrine and metabolic effects of long-term administration of [Nle27]growth hormone-releasing hormone-(1-29)-NH2 in age-advanced men and women
Khorram O, Laughlin GA, Yen SS · 1997 · Journal of Clinical Endocrinology & Metabolism
Goal-oriented comparisons and mechanism deep-dives that cover Sermorelin. Decision guides compare the realistic options for a goal (peptide / drug / lifestyle); mechanism dossiers walk the pathway in depth.
Decision guides all guides →
Starting point
Biomarker monitoring guide for peptide users
Read
Starting point
Compounding pharmacy regulatory landscape
Read
Starting point
DEA scheduling and criminal-law peptide landscape
Read
Starting point
IGF-1 lab platform reference range divergence
Read
Starting point
Pediatric peptide use review: approved, off-label, and the gray-market adolescent question
Read
Starting point
Peptide allergens and excipients reference
Read
Starting point
Peptide bioavailability comparison reference
Read
Starting point
Peptide cold-chain logistics and travel reference
Read
Starting point
Peptide dose conversion math reference
Read
Starting point
Peptide dosing in hepatic impairment: a reference
Read
Starting point
Peptide drug-drug interactions reference
Read
Starting point
Peptide injection technique: a technical reference
Read
Starting point
Peptide manufacturing technical reference
Read
Starting point
Peptide nomenclature and sequence notation reference
Read
Starting point
Peptide pharmacokinetics matrix
Read
Starting point
Peptide receptor pharmacology atlas
Read
Starting point
Peptide storage and stability technical reference
Read
Starting point
Peptide time-to-effect reference
Read
Starting point
Pregnancy and lactation peptide safety registry
Read
Starting point
WADA prohibited-status registry: peptides and competitive sport
Read
Mechanism dossiers
The published safety profile across both pediatric trials and small adult studies is dominated by mild, transient adverse events: injection-site reactions (most common), facial flushing, headache, and occasional dysgeusia. No significant adverse events were reported in the Khorram or Vittone 1997 cohorts, and the pediatric trial base reviewed in Prakash and Goa 1999 supports a similar profile in the indicated pediatric population. The shorter half-life and pulsatile-stimulation profile means sermorelin produces less sustained IGF-1 elevation than CJC-1295 with DAC; the IGF-1 amplitude is also lower than what tesamorelin produces at its FDA-labeled dose. The class-level cancer-mechanism caution that applies to any chronic IGF-1-elevating intervention still applies — IGF-1 is mitogenic for many tumor types in vitro, and chronic upward shift of the GH/IGF-1 axis is a different exposure pattern from native physiological pulsatility regardless of which receptor agonist produced the shift. Fluid retention, carpal-tunnel symptoms, and small glycemic shifts are documented for the GH-replacement literature as a class and remain theoretical concerns at higher chronic doses, though the controlled adult data on sermorelin specifically does not yet demonstrate them at typical practitioner-protocol exposures. Long-term human safety data in the modern adult off-label population — chronic dosing over years in non-deficient adults — is essentially absent.
Contraindications
- Active or past cancer (IGF-1 elevation has theoretical mitogenic interaction with many tumor types)
- Pregnancy or breastfeeding (no human data)
- Active proliferative retinopathy or other GH/IGF-1-sensitive ophthalmic disease
- Hypopituitarism or other GH-axis disease without endocrinologist oversight
- Hypersensitivity to sermorelin, mannitol, or related peptides
- Critical illness following open-heart or abdominal surgery, multiple trauma, or acute respiratory failure (class warning shared with GH-axis interventions broadly)
- Concurrent use of other GH-axis stimulators (CJC-1295, ipamorelin, MK-677, tesamorelin) without informed clinician oversight, given potentiation risk
- Athletes in WADA-tested competition (GHRH analogs are prohibited substances)
More like this in your inbox.
The free 6-page PDF — Top 10 Peptides Worth Knowing — covers the evidence and the boundaries on the peptides every curious biohacker eventually encounters.
One unsubscribe click ends it forever. The address is never sold and never shared with vendors.
07·Member discussion
No member discussion yet.
Member-only conversation lives here — cycle notes, practitioner commentary, pattern-matching. Be the first paying member to start the thread.