Insulin
Also known as: human insulin, regular insulin, Humulin, Novolin, lispro, Humalog, aspart, NovoLog, glulisine, Apidra, glargine, Lantus, Toujeo, detemir, Levemir, degludec, Tresiba, icodec, Awiqli, Fiasp, Lyumjev, Afrezza, Semglee
Insulin is the reference peptide therapy — the first hormone purified and given to a patient, the first protein synthesized by recombinant DNA technology, and the molecule against which every subsequent peptide-pharmacology claim is implicitly measured.
- Primary sources
- 5
- Mechanism dossiers
- 9
- Documented cycles
- 0
- Last reviewed
- 2026-05-18
5 tier 1
8 decision
Across all tiers
Insulin is the 51-amino-acid peptide hormone synthesized in pancreatic β-cells as a single-chain precursor (preproinsulin → proinsulin) and matured by proteolytic removal of the connecting C-peptide segment in the secretory granule. The mature molecule comprises a 21-residue A-chain (GIVEQCCTSICSLYQLENYCN) and a 30-residue B-chain (FVNQHLCGSHLVEALYLVCGERGFFYTPKT) joined by two interchain disulfide bridges (Cys-A7 to Cys-B7, Cys-A20 to Cys-B19) and stabilized by an intrachain A-chain disulfide (Cys-A6 to Cys-A11), folded into a compact globular structure of approximately 5808 Da. Recombinant-DNA expression of human insulin in Escherichia coli was first achieved by Goeddel et al. 1979, which cloned synthetic genes for the A and B chains as separate β-galactosidase fusion proteins, cleaved the insulin peptides chemically, and reconstituted the active hormone — the technological precondition for modern recombinant peptide pharmacology. The sibling proinsulin-cleavage product C-peptide is co-secreted in 1:1 molar ratio with mature insulin and remains the canonical biomarker of endogenous β-cell function.
Pharmacologically, insulin is an agonist at the insulin receptor (IR), a transmembrane tyrosine kinase in two splice isoforms (IR-A and IR-B). Ligand binding induces a conformational change in the preformed receptor dimer, trans-autophosphorylation, and recruitment of insulin receptor substrate proteins (IRS-1, IRS-2). The two principal downstream branches are the PI3K–Akt cascade (metabolic effects: GLUT4 translocation in muscle and adipose, suppression of hepatic gluconeogenesis, glycogen synthesis, lipogenesis, mTORC1-mediated protein synthesis) and the Ras–Raf–MEK–ERK cascade (mitogenic effects on cell proliferation). The insulin receptor shares roughly 50% sequence identity in the kinase domain with the IGF-1 receptor, and at supraphysiological concentrations insulin cross-activates IGF1R signaling — the pharmacological consideration underlying the long-running cancer-risk question for insulin analogs, and the connection point with IGF-1 LR3 and the broader GH–IGF-1 axis.
The pharmacokinetic story dominates the clinical pharmacology. Endogenous insulin is cleared with a plasma half-life of 4 to 6 minutes intravenously, with the liver extracting ~50% on first pass. Subcutaneous administration changes everything: native human insulin self-associates into zinc-stabilized hexamers and must dissociate to dimers and monomers for absorption, producing a 30-minute onset and 5–8 hour duration that does not match the timing of a meal. The modern analog era is a series of engineered substitutions that accelerate or prolong absorption. Lispro (Humalog, B28-Lys/B29-Pro reversal), aspart (NovoLog, B28-Asp), and glulisine (Apidra, B3-Lys/B29-Glu) destabilize hexamer self-association for 15-minute onset and 3–4 hour duration. Glargine (Lantus, A21-Gly plus B31/B32 di-Arg) shifts isoelectric point and precipitates at the injection site for slow re-solubilization, producing a flat 24-hour profile. Detemir (Levemir, B29-myristate) and degludec (Tresiba, B29-hexadecanedioic-acid linker) use fatty-acid acylation for albumin binding and a multi-hexamer depot, extending degludec's terminal half-life to ~25 hours. Icodec (Awiqli) extends the same principle further with a C20 diacid acylation and three substitutions (A14E, B16H, B25H) for self-association and IR-affinity modulation, yielding a terminal half-life of approximately 196 hours, as characterized in Kjeldsen et al. 2021. Hirsch, N Engl J Med 2005, 352:174–183 remains the canonical Drug Therapy review of the analog landscape.
Insulin is the original peptide therapy and the reference molecule for everything else on this site. The therapeutic arc begins with Banting, Best, Collip, Campbell, and Fletcher, Canadian Medical Association Journal 1922, 12:141–146 — the Toronto group's preliminary report of "pancreatic extracts in the treatment of diabetes mellitus," following the January 11, 1922 administration of an early extract at Toronto General Hospital and the refined Collip preparation of January 23, 1922 that produced the first unambiguous clinical response. Within twelve months Eli Lilly had a commercial product; over the following decades insulin was sequenced (Sanger, 1955), chemically synthesized (Katsoyannis and Du, 1963–1965), and crystallographically solved (Hodgkin, 1969). The recombinant human insulin produced by Genentech in 1979 became the first commercial recombinant-DNA drug when Humulin reached the U.S. market in 1982 — the technological precondition for somatropin, glucagon, every GLP-1 receptor agonist, and effectively every peptide drug in the modern formulary.
The clinical evidence base is the deepest of any peptide therapy. The Diabetes Control and Complications Trial (DCCT 1993) randomized 1,441 type 1 diabetes patients to intensive or conventional insulin therapy for a mean 6.5-year follow-up; intensive therapy reduced retinopathy development by 76% in primary prevention and slowed progression by 54% in secondary prevention, with concordant 39–60% reductions in microalbuminuria, clinical nephropathy, and clinical neuropathy. The UK Prospective Diabetes Study (UKPDS 33 1998) randomized 3,867 newly-diagnosed type 2 diabetes patients to intensive glucose control (sulfonylurea or insulin) versus conventional dietary therapy and reported a 25% reduction in microvascular endpoints over median 10-year follow-up. Together the two trials established that glycemic control matters, that insulin can deliver it, and that microvascular complications respond to sustained glycemic-burden reduction — the framework against which every subsequent diabetes-therapeutics trial is benchmarked.
The cardiovascular and cancer-safety record has been built across the following two decades. The ORIGIN trial (Gerstein, Bosch, Dagenais et al., N Engl J Med 2012, 367:319–328, n=12,537 with dysglycemia, 6.2-year median follow-up) reported a neutral effect of glargine on cardiovascular outcomes and no excess cancer at any site — the rebuttal to the breast-cancer signal raised in Hemkens, Grouven, Bender et al., Diabetologia 2009, 52:1732–1744, a German registry of 127,031 patients that had reported a dose-dependent association between glargine and malignancy. The DEVOTE trial (Marso, McGuire, Zinman et al., N Engl J Med 2017, 377:723–732, n=7,637, high-CV-risk type 2 diabetes) showed degludec non-inferior to glargine U100 on major adverse cardiovascular events and superior on severe hypoglycemia (4.9% vs 6.6%) — the basis for the modern preference for degludec over older basal analogs.
The once-weekly analog is the most significant insulin development of 2024–2026. The ONWARDS Phase 3 program for icodec spans six trials; the two most consequential are ONWARDS-1 (Rosenstock, Bain, Gowda et al., N Engl J Med 2023, 389:297–308, insulin-naïve type 2 diabetes, n=984, weekly icodec vs daily glargine U100, superior HbA1c reduction at 52 weeks with slightly higher clinically-significant hypoglycemia) and ONWARDS-2 (Philis-Tsimikas, Asong, Franek et al., Lancet Diabetes Endocrinol 2023, 11:414–425, basal-insulin-treated type 2 diabetes, n=526, switching from daily degludec to weekly icodec, superior HbA1c reduction at 26 weeks). Weekly basal insulin and weekly GLP-1 receptor agonists together reframe diabetes management as a once-weekly subcutaneous-injection paradigm, with daily multi-dose regimens reserved for type 1 disease and type 2 patients requiring prandial coverage. The FDA approved Awiqli for adult type 2 diabetes in March 2026 after a 2024 complete response letter citing hypoglycemia concerns in type 1 disease; EU and Swiss approvals preceded the US approval by approximately 18 months.
The biohacker context for insulin sits in a different register from most peptides on this site. Insulin is occasionally injected by competitive bodybuilders post-workout in the belief that pharmacological hyperinsulinemia enhances glucose and amino-acid delivery to muscle. The case-report literature is consistent: Evans and Lynch, Br J Sports Med 2003, 37:356–357 documented severe hypoglycemia in a non-diabetic bodybuilder injecting insulin for muscle-mass purposes; Heidet, Abdel Wahab, Ebadi et al., J Emerg Med 2019, 56:279–281 reported a 30-year-old bodybuilder presenting in coma from cryptic insulin injection. Insulin is the single most lethal pharmacological agent in the bodybuilding-enhancement category — more dangerous than any anabolic steroid, GH product, or peptide on this site — because the therapeutic-to-toxic ratio is narrow, severe hypoglycemia develops over minutes rather than hours, and the dose producing a marginal anabolic effect is close to the dose producing neuroglycopenic catastrophe. The peptide alternatives surveyed in the muscle preservation decision guide have nothing approaching this rapid-lethality profile in a non-diabetic person.
The GLP-1 receptor agonist era has reshaped insulin's clinical role substantially. A decade ago the standard type-2-diabetes escalation pathway after metformin failure ran through sulfonylureas to basal insulin to basal-bolus regimens; the GLP-1 receptor pharmacology dossier describes how that pathway has now been displaced for many patients by GLP-1 RAs and dual-agonists (liraglutide, semaglutide, tirzepatide) as second-line therapy. GLP-1 RAs lower glucose without the hypoglycemia and weight-gain liabilities that constrain insulin titration, and the cardiovascular outcome trials in the GLP-1 class (LEADER) have built an evidence base insulin does not match. Insulin remains essential in type 1 diabetes — where the pathophysiology is absolute deficiency and replacement is the entire therapeutic strategy — and in advanced type 2 disease beyond what any oral or GLP-1-class agent can supplement.
Modern type 1 management has shifted decisively toward closed-loop systems. The iDCL trial (Brown et al. 2019, n=168, Tandem Control-IQ vs sensor-augmented pump) reported an 11-percentage-point improvement in time-in-range at six months — the regulatory basis for the current hybrid closed-loop ecosystem (Control-IQ, Medtronic 780G, Beta Bionics iLet). Pumps universally use rapid-acting analog with algorithm-modulated basal delivery; weekly icodec sits outside this paradigm and will likely remain a non-pump option. On the access side, Semglee (insulin glargine-yfgn) became the first FDA-approved interchangeable insulin biosimilar in July 2021, substitutable for Lantus at the pharmacy without prescriber intervention; the Davies, Dahl, Heise et al., Diabet Med 2017, 34:1340–1353 review framed the earlier European biosimilar entrance. The biosimilar pathway has begun to constrain originator pricing without producing the compression observed in monoclonal-antibody biosimilars, particularly after the 2023 $35 monthly insulin cap for Medicare beneficiaries.
The honest framing has three parts. Insulin is the most clinically-validated peptide therapy ever marketed, with a century of safety data in indicated populations. The modern analog and once-weekly era extends but does not displace the underlying receptor pharmacology characterized through the 1970s–1990s; the analog-versus-human-insulin question is pharmacokinetic predictability and hypoglycemia risk rather than fundamental mechanism. And insulin's role in 2026 is being reshaped from the outside by the GLP-1 RA class — a rebalancing that will continue across the coming decade as outcome trials accumulate.
Each entry below is graded on the four-tier evidence scale (peer-primary → practitioner) and carries an independent strength label that captures how robustly the source supports the claim it backs on this page.
- Tier 1 · Peer primarystrongMolecular Engineering of Insulin Icodec, the First Acylated Insulin Analog for Once-Weekly Administration in Humans
Kjeldsen TB, Hubálek F, Hjørringgaard CU, et al. · 2021 · Journal of Medicinal Chemistry
- Tier 1 · Peer primarystrongSix-Month Randomized, Multicenter Trial of Closed-Loop Control in Type 1 Diabetes
Brown SA, Kovatchev BP, Raghinaru D, et al. · 2019 · New England Journal of Medicine
- Tier 1 · Peer primarystrongIntensive blood-glucose control with sulphonylureas or insulin compared with conventional treatment and risk of complications in patients with type 2 diabetes (UKPDS 33)
UK Prospective Diabetes Study (UKPDS) Group · 1998 · Lancet
- Tier 1 · Peer primarystrongThe effect of intensive treatment of diabetes on the development and progression of long-term complications in insulin-dependent diabetes mellitus
Diabetes Control and Complications Trial Research Group, Nathan DM, Genuth S, et al. · 1993 · New England Journal of Medicine
- Tier 1 · Peer primarystrongExpression in Escherichia coli of chemically synthesized genes for human insulin
Goeddel DV, Kleid DG, Bolivar F, et al. · 1979 · Proceedings of the National Academy of Sciences of the United States of America
Goal-oriented comparisons and mechanism deep-dives that cover Insulin. Decision guides compare the realistic options for a goal (peptide / drug / lifestyle); mechanism dossiers walk the pathway in depth.
Decision guides all guides →
Starting point
DEA scheduling and criminal-law peptide landscape
Read
Starting point
Peptide allergens and excipients reference
Read
Starting point
Peptide bioavailability comparison reference
Read
Starting point
Peptide cold-chain logistics and travel reference
Read
Starting point
Peptide dose conversion math reference
Read
Starting point
Peptide drug-drug interactions reference
Read
Starting point
Peptide injection technique: a technical reference
Read
Starting point
Peptide nomenclature and sequence notation reference
Read
Mechanism dossiers
The safety profile of insulin is defined by hypoglycemia, which is the dose-limiting toxicity for every formulation and the basis of every clinical dose-titration protocol. Severe hypoglycemia in the DCCT intensive arm occurred at approximately three times the rate of the conventional arm (62 vs 19 episodes per 100 patient-years requiring assistance) — the canonical demonstration that tighter glycemic control buys microvascular benefit at the cost of hypoglycemia exposure. Modern long-acting analogs reduce nocturnal and severe hypoglycemia relative to NPH and earlier analogs; the DEVOTE trial demonstrated a 27% relative reduction in severe hypoglycemia with degludec versus glargine U100 in type 2 diabetes, and ONWARDS-1 reported slightly higher rates of clinically-significant hypoglycemia with weekly icodec than with daily glargine in insulin-naïve type 2 patients — a signal that prompted the FDA's 2024 complete response letter when icodec was first considered for type 1 disease.
Weight gain is the second universal adverse effect, mediated by insulin's anabolic actions on adipose and by elimination of glycosuric calorie loss as glycemic control improves. DCCT intensive arm subjects gained approximately 4.6 kg on average — the dominant patient-experience reason for intensification resistance. The GLP-1 RA class produces the opposite weight trajectory at comparable glycemic effect, the principal therapeutic-experience reason for the shift in escalation pathways described above.
The cancer-risk question (discussed in the Overview) is the recurrent class-level safety concern, mechanistically grounded in IGF-1 receptor cross-activation at supraphysiological concentrations or at elevated IGF1R-affinity of certain analogs. The Hemkens 2009 signal has not been replicated in adequately-powered randomized designs, and the current regulatory consensus is that an analog-specific cancer signal is not supported by trial-grade evidence — with the caveat that multi-decade exposure data in younger populations remain limited.
Less common adverse events include lipohypertrophy at injection sites with chronic same-site use (a pharmacokinetic as well as cosmetic problem, since absorption from lipohypertrophic tissue is erratic), rare allergic reactions to insulin or excipients, and antibody formation that can in unusual cases produce insulin resistance. The inhaled formulation (Afrezza, Technosphere insulin) requires pulmonary-function monitoring and is contraindicated in chronic lung disease. The bodybuilder-misuse pattern documented in Evans and Lynch 2003 and Heidet et al. 2019 is the dominant non-diabetic safety concern. A specific operational consideration applies to weekly icodec: the ~196-hour half-life means a dose adjustment does not reach pharmacokinetic steady state for several weeks, and a hypoglycemic overdose has no rapid pharmacokinetic remedy beyond carbohydrate administration; the ONWARDS investigators developed a titration algorithm more conservative than daily-basal protocols.
Contraindications
- Hypoglycemia at the time of administration (absolute — every formulation is contraindicated until glucose is corrected)
- Hypersensitivity to insulin or to any excipient in the specific formulation (rare with modern recombinant products)
- Use of inhaled insulin (Afrezza) in patients with chronic lung disease including asthma and COPD (FDA black-box restriction; pulmonary-function-test monitoring required at baseline, six months, and annually)
- Non-diabetic use for performance-enhancement, bodybuilding, or muscle-anabolic purposes (severe hypoglycemia → seizure → coma → death is the documented case-report outcome; Evans and Lynch 2003, Heidet et al. 2019)
- Diabetic ketoacidosis without appropriate intravenous regular insulin protocol and electrolyte monitoring (subcutaneous insulin alone is inadequate for DKA management)
- Substitution between insulin products without appropriate clinical oversight (units of one insulin product are not interchangeable with units of another except where regulatory interchangeability designation applies, e.g., Semglee for Lantus)
- Athletes in WADA-tested competition without a valid therapeutic-use exemption (insulin is prohibited at all times under WADA S4.5)
- Use of weekly basal insulin (icodec) in patients with brittle type 1 diabetes or hypoglycemia unawareness without continuous glucose monitoring and clinical oversight
- Use of any insulin formulation in patients without the ability to recognize and treat hypoglycemia or without access to rapid carbohydrate sources
More like this in your inbox.
The free 6-page PDF — Top 10 Peptides Worth Knowing — covers the evidence and the boundaries on the peptides every curious biohacker eventually encounters.
One unsubscribe click ends it forever. The address is never sold and never shared with vendors.
07·Member discussion
No member discussion yet.
Member-only conversation lives here — cycle notes, practitioner commentary, pattern-matching. Be the first paying member to start the thread.