GIP
Also known as: glucose-dependent insulinotropic polypeptide, gastric inhibitory peptide, GIP, incretin
Physiological GIP was the metabolic peptide that was historically considered a 'fat hormone' for its lipid-storage promotion in adipose tissue — and yet pharmacological GIP-receptor agonism inside tirzepatide produces weight loss, not weight gain. The resolution of that paradox is the editorial center of why the dual-agonist class outperforms GLP-1 monoagonism.
- Primary sources
- 0
- Mechanism dossiers
- 1
- Documented cycles
- 0
- Last reviewed
- 2026-05-18
1 decision
Across all tiers
GIP is a 42-amino-acid peptide hormone — sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ — secreted from enteroendocrine K-cells of the duodenum and proximal jejunum in response to nutrient ingestion, principally carbohydrate and lipid. The precursor pro-GIP is cleaved by prohormone convertase 1/3 to release the mature 42-residue peptide, which circulates as the active form (Müller et al., Mol Metab 2025, 95:102118). The receptor is the GIP receptor (GIPR), a class B G-protein-coupled receptor expressed on pancreatic β-cells, adipocytes, osteoblasts, gastric chief cells, and several central-nervous-system populations including hypothalamic GABAergic neurons. Receptor engagement activates Gαs, adenylate cyclase, and the cAMP / protein kinase A cascade — the same canonical class B GPCR signaling tree that subserves GLP-1, glucagon, and the rest of the proglucagon-superfamily receptor pharmacology.
Three downstream effects matter for the pharmacology this site cares about. The first is glucose-dependent insulin secretion from pancreatic β-cells — the "insulinotropic" half of the modern name, characterized in the perfused isolated rat pancreas by Pederson and Brown, Endocrinology 1976, 99:780–785, who showed that GIP-stimulated insulin release was strictly conditional on ambient glucose concentration. Below a threshold glucose level, GIP does not stimulate insulin secretion at all; above it, the response scales with the prevailing hyperglycemia. The glucose-dependence is the safety feature that distinguishes incretin-class pharmacology from the older sulfonylurea hypoglycemia liability. The second effect is insulin-sensitization and lipid-storage promotion in adipose tissue — GIPR activation on adipocytes augments insulin-driven free-fatty-acid uptake and triglyceride storage, the mechanism that produced the historical "GIP makes you fat" framing across two decades of physiological and rodent-knockout work. The third effect is central, mediated by GIPR expression on hypothalamic neurons and brainstem circuits: modest food-intake suppression and apparent modulation of the nausea pathways that dominate GLP-1-class tolerability. Additional GIP effects span bone (osteoblast survival, bone-formation signaling) and gastric acid secretion (the original "inhibitory" framing, now considered a relatively minor pharmacological feature of the molecule).
The pharmacokinetics close the mechanism case for why native GIP is not a clinical drug. Intact GIP(1-42) has a plasma half-life of approximately 7 minutes — longer than native GLP-1's roughly 2-minute window but still far too short for chronic dosing — and dipeptidyl peptidase-4 (DPP-4) cleaves the N-terminal Tyr-Ala dipeptide to generate the inactive GIP(3-42) metabolite within minutes of secretion (Holst et al., Mol Cell Endocrinol 2009, 297:127–136). Only ~40–50% of circulating total GIP immunoreactivity is the intact biologically active peptide; the rest is the DPP-4 cleavage product. Every clinical GIP-receptor-active drug — tirzepatide, retatrutide, and the next-generation candidates behind them — solves this with the same engineering moves: an N-terminal modification that blocks DPP-4 cleavage, plus a fatty-acid moiety conjugated to a lysine residue that drives albumin binding and stretches plasma half-life to roughly one week. Native GIP is administered only as intravenous infusion under acute physiological-study conditions.
GIP belongs on this site because it is the parent hormone of the GIP arm of the modern dual-agonist class — the mechanistic innovation that distinguishes tirzepatide from the GLP-1 monoagonists (semaglutide, liraglutide, exenatide) and that, together with the glucagon-receptor arm, defines retatrutide and the experimental GIPR / GCGR co-agonist pharmacology behind it. The native hormone itself is a research tool. The clinical story belongs to the engineered analogs on the receptor.
The discovery story is older than GLP-1's. GIP was the first incretin characterized — the hormone whose existence anchored the modern "enteroinsular axis" concept of nutrient-stimulated insulin secretion. John Brown and Raymond Pederson at the University of British Columbia, working with Viktor Mutt at the Karolinska Institute, purified the peptide from porcine intestinal extracts across 1969–1971, reporting first an enterogastrone-active polypeptide that inhibited gastric acid secretion in dogs (Brown, Mutt and Pederson, J Physiol 1970, 209:57–64) and then the complete 42-residue porcine amino-acid sequence (Brown and Dryburgh, Can J Biochem 1971, 49:867–872). The original name — "gastric inhibitory polypeptide" — captured the acid-suppression effect that drove the purification work. The insulinotropic action was characterized five years later by Pederson and Brown in the perfused rat pancreas (Pederson and Brown 1976), demonstrating the strictly glucose-dependent stimulus-secretion coupling that established the molecule as the first incretin and ultimately motivated the renaming to "glucose-dependent insulinotropic polypeptide" while preserving the GIP acronym (Pederson, J Diabetes Investig 2016, 7 Suppl 1:4–7). GLP-1 was not characterized as a distinct insulinotropic hormone until the 1980s, after proglucagon was cloned and the tissue-specific post-translational processing of the prohormone in intestinal L-cells (which produce GLP-1) versus pancreatic α-cells (which produce glucagon) was worked out. GIP led; GLP-1 followed; for two decades GIP was the canonical incretin, and the modern dominance of GLP-1-class pharmacology in obesity and diabetes is a comparatively recent development.
A central paradox shaped the field for thirty years. The physiology of GIP, characterized across two decades of nutrient-clamp, infusion, and knockout work, was unambiguously lipid-storage-promoting in adipose tissue: GIPR-knockout mice on high-fat diets were leaner than wild-type controls and partially resistant to diet-induced obesity, and anti-GIPR monoclonal antibodies produced weight loss in obese rodents and non-human primates (Killion et al., Sci Transl Med 2018, 10(472):eaat3392). The Amgen anti-GIPR antibody program — and an adjacent body of academic work on GIPR antagonism — built a credible preclinical case that GIPR blockade, not activation, was the obesity-therapeutic direction. That hypothesis was the dominant frame across the GIP literature through approximately 2015, which made the pharmacological premise of tirzepatide — a GIP-receptor agonist component layered onto GLP-1 agonism — counter-intuitive at design time.
The clinical paradox crystallized when tirzepatide produced weight loss exceeding semaglutide head-to-head (Frias et al., N Engl J Med 2021, the SURPASS-2 head-to-head Phase 3) and obesity-class weight loss of −22.5% at 72 weeks in the foundational obesity trial (Jastreboff et al. 2022, SURMOUNT-1). The dual-agonist with the GIPR-activating arm outperformed the GLP-1 monoagonist by a margin that the "GIPR antagonism causes weight loss" framing could not accommodate. Two reconciliations followed. The first came from the Helmholtz Munich / Indiana University medicinal-chemistry consortium that originated the unimolecular dual-agonist design strategy: Mroz et al., Mol Metab 2019, 20:51–62 demonstrated that optimized long-acting GIP analogs — engineered for DPP-4 resistance and albumin-binding pharmacokinetics — produced weight loss in diet-induced obese mice through GIP-receptor agonism, that the weight effect was preserved in GLP-1R-knockout mice but abolished in GIPR-knockout mice, and that a fully potent long-acting GIPR antagonist did not lower body weight in the same model. Agonism, not antagonism, drove the obesity phenotype in the optimized-pharmacokinetic setting. The second reconciliation came from receptor pharmacology — Willard et al. 2020 characterized tirzepatide as imbalanced toward GIP-receptor potency and biased at the GLP-1 receptor toward cAMP signaling over β-arrestin recruitment, framing the dual-agonist signal as biased agonism rather than balanced co-stimulation. The implication is that pharmacological GIPR activation under supraphysiological dosing, biased signaling, and chronic receptor occupancy produces a tissue-specific effect profile that does not recapitulate the physiological GIP biology characterized in the rodent-knockout era. Possible mechanistic contributors include desensitization-and-functional-antagonism dynamics at the GIPR in adipose tissue, central appetite-circuit engagement through hypothalamic GIPR populations, and synergy with concurrent GLP-1-receptor activation that the physiological-GIP literature could not model.
The applied implication runs through the tirzepatide-versus-semaglutide weight-loss differential. In SURMOUNT-1, the 15-mg tirzepatide arm reached −22.5% body weight at 72 weeks; in STEP 1, the 2.4-mg semaglutide arm reached −14.9% at 68 weeks. The roughly 7-point treatment-difference advantage is the editorial center of why the dual-agonist class is the new metabolic frontier rather than an incremental refinement on GLP-1 monoagonism. How much of that advantage is attributable to the GIP arm specifically — as opposed to differences in GLP-1-receptor partial agonism, biased signaling, or dosing intensity — is the active mechanistic question. The Perez-Tilve 2026 BWB3054 paper extended the dissection further by demonstrating that a GIPR:GCGR co-agonist with >100-fold attenuated GLP-1R activity matched retatrutide's weight effect in diet-induced obese mice — including in GLP-1R-knockout animals — re-framing the GIP and glucagon arms as carrying a substantial share of the obesity load independent of GLP-1R signaling.
The class context across the corpus follows the same receptor-engagement breadth story. The GLP-1 receptor pharmacology dossier walks the monoagonist → dual-incretin → triple-agonist progression; the peptide receptor pharmacology atlas covers the broader class B GPCR landscape; the fat-loss decision guide addresses applied positioning. The GIP-receptor arm currently belongs exclusively to tirzepatide among approved drugs and retatrutide among late-stage candidates — the adjacent dual-agonist class composed of mazdutide, survodutide, and pemvidutide pairs GLP-1 with glucagon-receptor agonism and skips the GIP arm, while cagrilintide operates outside the incretin axis entirely on the amylin receptor.
The honest framing has three parts. First, native GIP is not a drug — it is the parent hormone whose receptor is the pharmacological target, and the molecules acting on that receptor in human medicine are engineered analogs rather than the native sequence. Second, the historical "GIP makes you fat" framing is not wrong about physiological GIP biology — adipose lipid storage is a real GIPR effect — but the reconciliation with the clinical pharmacology runs through the difference between physiological and supraphysiological dosing, biased agonism, and tissue-specific receptor dynamics the early knockout literature could not model. Third, the relative arm contributions inside tirzepatide and retatrutide remain partially open questions; the receptor-pharmacology, preclinical-knockout, and emerging GIPR-only programs are collectively the ongoing experimental dissection, and no GIP-receptor-only agonist has yet reached clinical approval.
Goal-oriented comparisons and mechanism deep-dives that cover GIP. Decision guides compare the realistic options for a goal (peptide / drug / lifestyle); mechanism dossiers walk the pathway in depth.
Decision guides all guides →
The acute pharmacology of native GIP infusion in human physiological studies is well-characterized and uneventful at near-physiological doses — intravenous GIP infusion is a standard tool of nutrient-clamp endocrinology research and has been used for decades without notable adverse-event reporting. There is no chronic-dosing native-GIP human safety record because no chronic-dosing native-GIP application exists; the molecule's pharmacokinetics preclude it. The chronic GIPR-activation safety story that matters for readers belongs to tirzepatide and retatrutide — characterized across the SURMOUNT, SURPASS, and TRIUMPH programs and the surrounding pharmacovigilance literature — and is addressed on those entries. The class-shared safety considerations of GLP-1 / GIP / glucagon-receptor activation (GI tolerability, medullary thyroid carcinoma boxed warning carried from rodent C-cell data, pancreatitis, gallbladder disease, modest chronotropic effect, evolving NAION and psychiatric signals) apply to those engineered analogs rather than to native GIP as a research tool.
Contraindications
- Use outside of physiological research protocols is not clinically indicated — there is no therapeutic native-GIP application, and the entry on this site exists to document the parent hormone of the dual-agonist class rather than to support self-administration
- Personal or family history of medullary thyroid carcinoma or multiple endocrine neoplasia type 2 syndrome (class consideration for any incretin-axis pharmacology, although the rodent C-cell data driving the FDA boxed warning are GLP-1-receptor-specific)
- Active or recent eating disorder, pregnancy, breastfeeding, and significant gastrointestinal motility disease are class-consideration exclusions for any incretin-class pharmacology, by extension to the engineered GIPR-active analogs covered on the tirzepatide and retatrutide entries
More like this in your inbox.
The free 6-page PDF — Top 10 Peptides Worth Knowing — covers the evidence and the boundaries on the peptides every curious biohacker eventually encounters.
One unsubscribe click ends it forever. The address is never sold and never shared with vendors.
07·Member discussion
No member discussion yet.
Member-only conversation lives here — cycle notes, practitioner commentary, pattern-matching. Be the first paying member to start the thread.