Peptides Dossier — citation verifiedPeptides Dossier.

Encyclopedia

Metabolic / GLP-1

GLP-1

Also known as: glucagon-like peptide-1, GLP-1, GLP-1(7-36)amide, GLP-1(7-37), proglucagon (78-107)

GLP-1 is the reference molecule for the most clinically successful peptide drug class of the 21st century; its 1-to-2-minute plasma half-life is the single pharmacokinetic constraint every commercial GLP-1 receptor agonist is engineered to solve.
Primary sources
0
Mechanism dossiers
2

1 decision

Documented cycles
0

Across all tiers

Last reviewed
2026-05-18
01·Mechanism

GLP-1 is a 30-to-31-amino-acid peptide hormone cleaved from the proglucagon precursor by prohormone convertase 1/3 in intestinal L-cells of the distal small intestine and colon, with smaller populations in pancreatic α-cells and hindbrain neurons. The sequence — HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 — corresponds to proglucagon residues 78-107 in the GLP-1(7-36)amide nomenclature that distinguishes the truncated bioactive forms from the largely inert full-length GLP-1(1-37). Two equipotent biologically active forms circulate: GLP-1(7-36)amide (the dominant form, approximately 80% of circulating active GLP-1) and GLP-1(7-37); the C-terminal amidation versus glycine extension is functionally equivalent at the GLP-1 receptor. The same proglucagon gene yields glucagon in pancreatic α-cells (via prohormone convertase 2) and GLP-1 and GLP-2 in intestinal L-cells (via prohormone convertase 1/3) — the tissue-specific post-translational processing established in Mojsov S, Heinrich G, Wilson IB et al., J Biol Chem 1986, 261:11880–11889 on the molecular precursor architecture defined in Bell GI, Sanchez-Pescador R, Laybourn PJ, Najarian RC, Nature 1983, 304:368–371.

The bioactivity of the truncated GLP-1(7-37) form — versus the inactivity of GLP-1(1-37) — was established in Mojsov S, Weir GC, Habener JF, J Clin Invest 1987, 79:616–619, an isolated-perfused-rat-pancreas study showing that low-picomolar GLP-1(7-37) stimulated insulin secretion in glucose-dependent fashion while GLP-1(1-37) was inert; parallel work by Drucker DJ, Philippe J, Mojsov S, Chick WL, Habener JF, Proc Natl Acad Sci USA 1987, 84:3434–3438 demonstrated GLP-1 stimulates insulin gene expression and raises cyclic AMP in a rat islet cell line. Together these 1987 papers established the molecule as an incretin and anchored the broader recognition that the incretin axis was the diminished signal underlying the impaired insulin response to oral versus intravenous glucose in type 2 diabetes characterized in Nauck MA, Stockmann F, Ebert R, Creutzfeldt W, Diabetologia 1986, 29:46–52.

The GLP-1 receptor (GLP1R) is a class B G-protein-coupled receptor signaling primarily through Gαs to adenylate cyclase and the cAMP / protein kinase A cascade, with parallel β-arrestin recruitment and biased agonism that several engineered agonists exploit. The receptor distribution explains the systemic effects of a nominally gut peptide: pancreatic β-cells (glucose-dependent insulin secretion) and α-cells (glucagon suppression), enteric neurons and gastric smooth muscle (slowed gastric emptying), hypothalamic NPY/AgRP and POMC neurons and hindbrain area postrema / nucleus tractus solitarius circuits (centrally mediated appetite suppression and meal termination), ventral tegmental area and nucleus accumbens dopaminergic circuits (food-reward attenuation that overlaps with the substance-use-disorder signals emerging from the semaglutide and liraglutide literature), cardiomyocytes and vascular endothelium, and renal proximal tubular cells. The receptor pharmacology across the modern era is consolidated in Drucker DJ, Cell Metab 2018, 27:740–756 and Nauck MA, Quast DR, Wefers J, Meier JJ, Mol Metab 2021, 46:101102.

The pharmacokinetic ceiling on native GLP-1's therapeutic use is the central design problem of the entire receptor agonist drug class. The 1-to-2-minute plasma half-life was characterized in Deacon CF, Nauck MA, Toft-Nielsen M, Pridal L, Willms B, Holst JJ, Diabetes 1995, 44:1126–1131, which administered intact GLP-1(7-36)amide subcutaneously and intravenously to type II diabetic and healthy subjects and quantified the rapid NH2-terminal degradation by dipeptidyl peptidase-IV (DPP-IV / CD26) at the Ala8-Glu9 bond. Cleavage produces GLP-1(9-36)amide, a fragment with essentially no agonist activity at GLP-1R in standard assays — though a minor body of literature attributes residual cardiovascular and metabolic effects to (9-36) that remain mechanistically uncertain. Deacon established that the half-life problem was not principally renal or hepatic clearance but enzymatic degradation, and that DPP-IV inhibition or DPP-IV-resistant peptide engineering would be the two parallel pharmacological solutions the field would pursue. The comprehensive physiology of GLP-1 is consolidated in Holst JJ, Physiol Rev 2007, 87:1409–1439, still the canonical review almost two decades past publication.

02·Overview

Native GLP-1 occupies an unusual position: it is simultaneously the endogenous reference molecule for the most commercially successful peptide drug class in pharmaceutical history — semaglutide alone ranks among the top five best-selling drugs globally as of 2026 — and a molecule with essentially no clinical product of its own. The arc from native peptide to drug class is the central editorial story.

The clinical translation problem was the 1-to-2-minute plasma half-life. The Deacon 1995 Diabetes characterization made native GLP-1 unsuitable for any chronic dosing schedule outside continuous intravenous infusion, and the field has pursued two parallel pharmacological solutions ever since. The first is structural engineering of the peptide to resist DPP-IV cleavage and extend plasma residence — the GLP-1 receptor agonist drug class. The second is pharmacological inhibition of DPP-IV itself — the gliptin class (sitagliptin, FDA-approved 2006; saxagliptin, 2009; linagliptin, 2011; and others) — which extends the residence time of endogenous GLP-1 and GIP without administering exogenous peptide. The two occupy different positions in current diabetes practice: the receptor agonist class produces supraphysiological engagement, large weight-loss magnitudes, and the cardiovascular-outcomes benefit anchored by SUSTAIN-6, LEADER, and SELECT; the DPP-IV inhibitor class produces modest HbA1c reduction at near-physiological GLP-1 elevation, is weight-neutral, and has not produced comparable cardiovascular signal. The GLP-1 receptor pharmacology dossier develops the receptor-engagement-breadth question across the modern obesity-pharmacotherapy landscape.

The receptor agonist class divides along two engineering strategies for the half-life problem. The first uses a non-human peptide backbone — exendin-4, the Gila monster (Heloderma suspectum) salivary peptide sharing roughly 53% sequence identity with native GLP-1 but carrying a glycine at position 2 that resists DPP-IV cleavage. Exenatide (FDA-approved 2005 as Byetta) is the synthetic version; lixisenatide is an exendin-4 derivative. The second strategy uses an engineered human-GLP-1 backbone with DPP-IV-resistance modifications plus a fatty-acid acylation moiety that binds plasma albumin and slows renal clearance. Liraglutide (FDA-approved 2010 for diabetes, 2014 for weight management) was first to use that architecture. Semaglutide (FDA-approved 2017, 2021) layers an α-aminoisobutyric acid substitution at position 8 with a C18 fatty diacid on Lys26 via a γ-glutamic-acid / OEG linker — yielding an approximately week-long plasma half-life that enables once-weekly subcutaneous dosing. Tirzepatide extends the same albumin-binding architecture to a dual GIP / GLP-1 agonist on a GIP-derived backbone; retatrutide, survodutide, pemvidutide, and mazdutide extend the engineering across additional receptor combinations including glucagon. The amylin-based cagrilintide is sometimes co-formulated with semaglutide.

The oral-bioavailability problem is a related but distinct engineering challenge. The Rybelsus oral semaglutide formulation that received FDA approval in 2019 addressed it through coformulation with sodium N-(8-[2-hydroxybenzoyl]amino)caprylate (SNAC), characterized in Buckley ST, Bækdal TA, Vegge A et al., Sci Transl Med 2018, 10(467):eaar7047. SNAC produces a localized stomach microenvironment of approximately pH 5 at the tablet-mucosa interface, inactivating pepsin and enabling transcellular absorption of intact semaglutide through gastric epithelium — gastric rather than intestinal, compound-specific to semaglutide, not tight-junction-mediated. The bioavailability remains low (roughly 1%) but sufficient at therapeutic oral magnitude.

The pharmacology-of-mimetics frame is the central conceptual point. The engineered class achieves clinical outcomes — sustained appetite suppression, 15-to-25% weight loss, glycemic control, cardiovascular event reduction — that native GLP-1 cannot, because the engineered molecules deliver sustained receptor engagement that the native half-life does not permit. But the class is also constrained by what native GLP-1 can do: every clinical effect traces back to a native GLP-1 receptor present somewhere in human physiology, and the dose-response and tolerability ceiling of the class is set by underlying receptor biology rather than by molecular engineering. Class-shared GI side effects, the rodent-derived medullary-thyroid-carcinoma boxed-warning concern, the post-discontinuation weight-regain pattern, and the lean-mass-loss conversation all reflect native GLP-1 receptor biology rather than idiosyncrasies of any one engineered molecule. The fat-loss decision guide and the peptide receptor pharmacology atlas walk the comparative clinical positioning. The trajectory from exenatide's 2005 approval through retatrutide's late-stage development is the cleanest receptor-pharmacology-to-clinical-magnitude story in modern metabolic medicine, and the absence of native chronic-dosing safety data is the structural reason long-tail signals (NAION, suicidal ideation, severe gastroparesis, lean-mass-loss proportionality) require ongoing characterization at the population scale the class has now reached.

03·Methodological caveats
04·Applied translation
06·Related dossiers + decision guides

Goal-oriented comparisons and mechanism deep-dives that cover GLP-1. Decision guides compare the realistic options for a goal (peptide / drug / lifestyle); mechanism dossiers walk the pathway in depth.

Decision guides all guides →

Mechanism dossiers

08·Safety

Native GLP-1 is not a marketed product and is not used in chronic clinical dosing schedules, so the safety profile is characterized primarily through short-duration human pharmacology studies and the longer-duration engineered-analog literature. The pharmacology-derived concerns track the GLP-1 receptor agonist class labels. The dominant acute effect of native GLP-1 infusion is gastrointestinal — nausea is the most commonly reported acute symptom, dose-dependent, and consistent with the slowed-gastric-emptying mechanism. Hypoglycemia is uncommon as a primary effect because GLP-1 receptor activation drives insulin secretion in glucose-dependent fashion, but the safety margin narrows sharply when native GLP-1 is co-administered with insulin or sulfonylureas.

The chronic-dosing safety profile is the question the engineered class is characterizing at population scale. Class-shared signals include the FDA boxed warning for medullary thyroid carcinoma based on rodent C-cell tumor data at supratherapeutic doses, the acute pancreatitis signal from early observational analyses, the NAION signal that emerged in 2024-2025 observational analyses of semaglutide, the suicidal-ideation pharmacovigilance signal that the FDA's 2024 review did not confirm as causal, and the gastroparesis case-report literature. The cardiovascular-outcomes evidence base is positive in both T2D (SUSTAIN-6, LEADER) and obesity without diabetes (SELECT), though those readouts derive from semaglutide and liraglutide specifically and do not transfer automatically to the dual- and triple-agonist molecules whose long-tail safety story is still being developed.

The off-label use case where biohacker conversation occasionally surfaces native GLP-1 — typically through research-chemical channels marketing the parent peptide as a less expensive alternative to compounded semaglutide or tirzepatide — carries the same structural pharmacokinetic limitation as native GLP-2. The 1-to-2-minute plasma half-life means any subcutaneous schedule producing chronic effect requires either multiple-times-daily injection at impractical frequency, co-administration of a DPP-IV inhibitor (itself a separate prescription-only class), or implicit acceptance that the dose produces transient receptor engagement rather than the sustained pharmacology the engineered analogs deliver. The mechanism is identical to the analogs; the residence-time-mediated dose-response is not.

Contraindications

  • Personal or family history of medullary thyroid carcinoma or multiple endocrine neoplasia type 2 syndrome (class-effect FDA boxed warning across approved GLP-1 receptor agonists; precaution by analogy for native GLP-1)
  • Pregnancy and breastfeeding (no controlled human data; the engineered analogs carry pregnancy contraindication labels)
  • History of severe or recurrent pancreatitis
  • Severe gastroparesis or other significant GI motility disease (the slowed-gastric-emptying mechanism is directly contraindicated)
  • Active or recent eating disorder (the appetite-suppressive mechanism is directly contraindicated)
  • Concurrent insulin or sulfonylurea therapy without endocrinologist oversight (hypoglycemia risk amplification)
  • Concurrent use of other GLP-1 receptor agonists or dual / triple incretin agonists (semaglutide, liraglutide, exenatide, tirzepatide, retatrutide, lixisenatide, survodutide, pemvidutide, mazdutide, cagrilintide co-formulations) — no rationale for combining within the receptor system and cumulative GI burden
  • Concurrent use of DPP-IV inhibitors (sitagliptin, saxagliptin, linagliptin, alogliptin) — DPP-IV inhibition extends endogenous GLP-1 residence time, and stacking with exogenous GLP-1 or analog produces uncharacterized additive exposure
  • Known hypersensitivity to GLP-1 or to research-grade synthesis impurities
  • Absence of any approved clinical indication — native GLP-1 use outside characterized research protocols does not have a coherent regulatory or evidentiary pathway

More like this in your inbox.

The free 6-page PDF — Top 10 Peptides Worth Knowing — covers the evidence and the boundaries on the peptides every curious biohacker eventually encounters.

One unsubscribe click ends it forever. The address is never sold and never shared with vendors.

Educational only. Not medical advice. Consult a qualified clinician before any peptide use.

Last reviewed: 2026-05-18

07·Member discussion

No member discussion yet.

Member-only conversation lives here — cycle notes, practitioner commentary, pattern-matching. Be the first paying member to start the thread.